b

 

c

 

d

 
 

 


Figure 1. Structures des quinolones.

(a) Structure de base des quinolones et rôle des substituants ; A et B indiquent les cycles, les numéros indiquent la position des substituants (d’après [41]). (b) Structure de l’acide nalidixique, quinolone de première génération. (c) Structures de fluoroquinolones de deuxième génération utilisées dans cette étude. (d) Structure d’une fluoroquinolone de troisième génération.


 

Mycinose

 
 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 2. Structure de deux macrolides naturels, l’érythromycine A, macrolide à 14 chaînons, et la tylosine, macrolide à 16 chaînons.

 

 

 

 

Tableau 1. Origine des macrolides naturels.

 

Macrolide

Nombre de chaînons

Organisme producteur

Erythromycine

14

Saccharopolyspora erythraea

Oléandomycine

14

Streptomyces antibioticus

Carbomycine

16

Streptomyces thermotolerans

Josamycine

16

Streptomyces narbonensis var. josamycetius nova sp

Midécamycine

16

Streptomyces mycarofaciens

Spiramycine

16

Streptomyces ambofaciens

Tylosine

16

Streptomyces fradiae

 


 

 

 

 

 

 

 

 

 

 

 

Figure 3. Structure d’un kétolide, la télithromycine.

 

Figure 4. Structure de la lincomycine et de son dérivé chloré, la clindamycine.

 

 

Figure 5. Structure des streptogramines B, pristinamycine IA et quinupristine, et des streptogramines A, pristinamycine IIA et dalfopristine.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 6. Schéma du mode d’action des quinolones sur l’ADN gyrase, d’après [83].

(a) L’ADN gyrase et l’ADN interagissent et forment un complexe de clivage. (b) Effet bactériostatique des quinolones qui piègent le complexe de clivage de manière réversible, sauf lorsque l’ADN gyrase présente des mutations. (c) Libération irréversible de fragments d’ADN coupés à partir des complexes de clivage, faisant intervenir un facteur protéique non déterminé (voie sensible au chloramphénicol), entraînant la mort cellulaire. (d) Dissociation irréversible des sous-unités de l’ADN gyrase sous l’action des quinolones et libération de fragments d’ADN coupés (voie non sensible au chloramphénicol).


 

 

 

Figure 7. Structure secondaire de l’ARNr 23S (d’après [18]).

Les hélices sont numérotées selon Leffers et al. [198]. La boucle centrale du domaine V et l’épingle 35 du domaine II, impliquées dans la liaison des macrolides, sont désignées par des flèches.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 8. Structure de la sous-unité 50S du ribosome de Deinococcus radiodurans complexée à l’érythromycine [375].

L’antibiotique, en rouge, est fixé dans le tunnel de sortie des polypeptides. Les protéines ribosomiques sont en jaune, l’ARNr 23S est en bleu foncé et l’ARNr 5S est en bleu clair.

 

 


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 9. Le tunnel de sortie des polypeptides (d’après [290]).

(A) La sous-unité 50S a été coupée en deux dans la longueur du tunnel et ouverte comme un livre. L’ARNr est en bleu clair; les protéines sont en vert. PT, centre peptidyltransférase. (B) Localisation des domaines de l’ARNr 23S et des protéines ribosomiques (L) autour du tunnel.


 

 

Figure 10. Représentation schématique de la paroi des bactéries à Gram positif, des bactéries à Gram négatif et des mycobactéries [151].

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 11. Représentation schématique de la membrane externe de la paroi des bactéries à Gram négatif [151].


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 12. Représentation schématique des différents systèmes d’efflux actif, d’après [319].

ATB, antibiotique substrat.


 

 

 

 

 

 

 

 

 

 

 

 

Figure 13. Organisation modulaire des protéines ABC.

Distinction entre les protéines ABC bactériennes, formées de plusieurs protéines (une couleur par protéine) et leurs homologues eucaryotes où généralement une protéine constitue le transporteur complet. Les flèches rouges indiquent la direction du transport ; dans le cas des systèmes d’import bactériens, la protéine extracellulaire liant le substrat est figurée en gris.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 14. Organisation structurale des transporteurs ABC.

Les deux domaines transmembranaires (TMD) sont chacun constitué de 6 hélices a membranaires. Les domaines de fixation des nucléotides (NDB) sont situés du côté cytoplasmique de la membrane et contiennent les motifs conservés impliqués dans l’hydrolyse de l’ATP (motifs Walker A et Walker B, motif Signature). Les résidus les plus conservés de ces motifs sont indiqués.


 

 

 

 

 

 

 

 

Figure 15. Représentation schématique des motifs conservés d’un domaine liant les nucléotides.


Tableau 2. Protéines de la famille ABC cristallisées.

 

Nom

Organisme

Fonction

Résolution (Å)

Références

Cristaux obtenus

Domaines liant les nucléotides isolés

 

 

 

CFTR

Souris

Canal Cl-

2,2 à 2,55

[199]

Sans nucléotide, avec ADP, avec ATP

CysA

A. acidocaldarius

Import des sulfates (supposé)

2,0

[374]

Sans nucléotide

GlcV

S. solfataricus

Import du glucose

1,65 à 2,1

[421]

Sans nucléotide, avec ADP-Mg2+, avec AMP-PNP- Mg2+

HisP

S. typhimurium

Import de l’histidine

1,5

[145]

Avec ATP

HlyB

E. coli

Export de l’hémolysine

2,6

[377]

Sans nucléotide

MalK

T. litoralis

Import du maltose

1,9

[78]

Avec pyrophosphate

MalK

E. coli

Import du maltose

2,6 à 2,9

[54]

Sans nucléotide et avec ATP

MJ0796

M. jannaschii

?

2,7

[450]

Avec ADP-Mg2+

   mutant E171Q

 

1,9

[389]

Avec ATP-Na+

MJ1267

M. jannaschii

Transport des acides aminés Leu, Ile, Val (supposé)

1,6

[170]

Sans nucléotide et avec ADP-Mg2+

RbsA

E. coli

Import du ribose

2,5

[14]

 

TAP1

H. sapiens

Présentation de l’antigène

2,4

[102]

Avec ADP-Mg2+

 

 

 

 

 

 

Transporteurs ABC complets

 

 

 

 

BtuCD

E. coli

Import de la vitamine B12

3,2

[214]

 

MsbA

E. coli

Export du lipide A et du LPS

4,5

[51]

 

 

V. cholera

3,8

[50]

 

 

S. typhimurium

4,2

[345]

Avec Mg-ADP-Vi et LPS

 

 

 

 

 

 

Autres protéines ABC

 

 

 

 

MutS

E. coli

Réparation de l’ADN

2,2

[192, 301]

 

SMC

T. maritima

Maintenance structurale des chromosomes

3,1

[222]

 

 

 

 

 

 

 

 

 

 

 

 

(à suivre)

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Tableau 2. Protéines de la famille ABC cristallisées. (suite)

 

 

 

 

 

Nom

Organisme

Fonction

Résolution (Å)

Références

Cristaux obtenus

Rad50

P. furiosus

Réparation de l’ADN double brin

1,6 à 2,6

[137]

Sans nucléotide, avec ATP, avec AMP-PNP- Mg2+

   mutant S179R

 

2,1

[260]

 

RLI

P. furiosus

Biogénèse du ribosome, formation du complexe de translation…

1,9

[168]

Avec Mg2+-ADP

AMP-PNP, Adénosine 5’(b-g-imido) triphosphate, LPS, lipopolysaccharide ; Vi, vanadate inorganique.


 

Figure 16. Structure du domaine liant les nucléotides HisP en présence d’ATP [145].

Les hélices a sont représentées en jaune, les feuilles b en vert, la molécule d’ATP est représentée en rouge.

 

 


 

 

Figure 17. Représentation des différentes orientations relatives des domaines liant les nucléotides des protéines ABC.

(1) Structures cristallographiques de dimères de NBD de HisP (a), Rad50 (b) et MalK (c). L’ATP est figuré en bâtons rouges. (2) Schémas des orientations relatives des NBD des protéines ABC HisP, MalK, Rad50 et de l’ATPase ArsA, d’après [175]. S indique le motif Signature et P le motif Walker A.


 

 

Figure 18. Représentation schématique des interactions entre ATP-Mg2+ et les résidus du domaine liant les nucléotides de HlyB [451].

Les résidus des motifs Walker A (en rouge) et Walker B (en rose), ainsi que de la D-loop (en noir) et de la Q-loop (en marron) appartiennent à un domaine liant les nucléotides (site cis) alors les résidus du motif Signature (en bleu) appartiennent à l’autre domaine liant les nucléotides du dimère de HlyB (site trans).


 

Figure 19. Cycle catalytique d’un transporteur ABC d’après [129], cas d’un système d’export.

 

Etape 1 : le cycle de transport débute avec la liaison du substrat au niveau des TMD, un changement de conformation est transmis aux NBD, ce qui facilite la liaison des deux molécules d’ATP et diminue l’énergie de formation du dimère fermé.

Etape 2 : la liaison des deux molécules d’ATP entraîne la formation du dimère fermé et une diminution de l’affinité du site de liaison du substrat [129, 353]. Il est supposé que le substrat est relâché à cette étape.

Etape 3 : l’ATP est hydrolysé, cette hydrolyse semble initier le retour du transporteur à son état initial, avec un dimère ouvert, en déstabilisant le dimère fermé par des répulsions électrostatiques.

Etape 4 : libération de phosphate inorganique puis d’ADP et retour à une conformation ouverte du dimère.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 20. Représentation en ruban du système d’import de la vitamine B12 de E. coli, d’après [213].

Le transporteur ABC complet BtuCD est composé de quatre sous-unités : deux NBD, BtuD, en vert et bleu, et deux domaines transmembranaires, BtuC, en rouge et jaune [214]. Deux molécules de cyclotétravanadate occupent les sites de liaison des nucléotides des deux NBD. L’orientation relative de BtuCD et BtuF, la protéine extracellulaire liant la vitamine B12 [34], faite manuellement, positionne les résidus conservés de BtuC et BtuF en face-à-face, et la molécule de vitamine B12 se situe ainsi au niveau de l’ouverture du canal formé par BtuC [213].

 

 

Figure 21. Modèle proposé pour le transport du lipopolysaccharide par MsbA [345].

Les domaines liant les nucléotides de MsbA ne sont pas représentés. (A) Le lipopolysaccharide (LPS) se lie à l’hélice elbow (structure fermée). (B) Les têtes lipidiques du LPS s’insèrent dans la chambre formée par les hélices membranaires. (C) La protéine subit des changements de conformation suite à la liaison et l’hydrolyse de l’ATP. (D) Le LPS est situé au niveau de la membrane externe, comme observé dans la structure de MsbA de S. typhimurium.


Tableau 3. Transporteurs ABC impliqués dans la résistance spécifique aux antibiotiques.

 

Transporteur

Organisme

Substrats

Références

Organismes producteurs

 

 

Ard1

S. capreolus

A201A

[20]

AviABC1 - AviABC2

S. viridochromogenes

Avilamycine

[435]

BcrABC

B. licheniformis

Bacitracine

[321]

Car(A)

S. thermotolerans

Carbomycine (M16)

[381]

DrrAB

S. peuceticus

Anthracyclines

[171]

Ert(X)

S. erythraea

Erythromycine ? (M14)

[299]

LmrB

L. lactis

Bactériocines

[97]

Lmr(C)

S. lincolnensis

Lincomycine (L)

[317]

Ole(B)

S. antibioticus

Oléandomycine (M14)

[296]

Ole(C) – Ole(C5)

S. antibioticus

Oléandomycine (M14)

[351]

Srm(B)

S. ambofaciens

Spiramycine (M16)

[381]

Tlr(C)

S. fradiae

Tylosine (M16)

[359]

TnrB

S. longisporoflavus

Tétronasine

[209]

Var(M)

S. virginiae

Virginiamycine (S)

[172]

Organismes non producteurs

 

 

BcrAB

E. faecalis

Bacitracine

[233]

DrrAB

M. tuberculosis

Anthracyclines

[64]

Lsa

E. faecalis

L, SA

[388]

MacB

E. coli

M14-15

[182]

Msr(A)

S. epidermidis

M14-15, SB

[357]

Msr(C)

E. faecium

M, SB

[386]

Msr(D)

Streptococcus spp.

M14-15-16

[74]

Rv2686c - Rv2687c - Rv2688c

M. tuberculosis

Fluoroquinolones

[306]

Vga(A)

S. aureus

L, SA

[9, 56]

Vga(B)

S. aureus

S

[8, 56]

L, lincosamides ; M14, M15, M16, macrolides à 14, 15 et 16 chaînons ; SA, SB, streptogramines A et B ; ?, transporteur supposé.

 

 

Tableau 4. Transporteurs ABC conférant une résistance de type MDR.

 

Transporteur

Organisme

Substrats

Références

BmrA

B. subtilis

EtBr, H33342, doxorubicine, 7-aminoactinomycin D

[390]

EfrAB

E. faecalis

CIP, NOR, doxycycline, anthracyclines, ACR, DAPI, TPP+

[197]

HorA

L. brevis

Iso-a-acids, novobiocine, EtBr, H33342

[366]

LmrA

L. lactis

AM, C, FQ, MLS, TC, vinca alkaloids, anthracyclines, colchicine, EtBr, valinomycine, nigéricine, H33342

[417]

Md1-Md2

M. hominis

CIP, NOR, ACR, EtBr

[338]

Msr

S. rochei F20

M, TC, doxorubicine

[90]

VcaM

V. cholerae non-O1

CIP, NOR, TC, anthracyclines, DAPI, H33342

[144]

YdaG-YdbA

L. lactis

EtBr, daunomycine

[223]

ACR, acriflavine ; AM, aminoglycosides ; C, chloramphénicol ; CIP, ciprofloxacine ; DAPI, 4’,6-diamidino-2-phénylindole ; EtBr, bromure d’éthidium ; FQ, fluoroquinolones ; H3342, Hoechst 33342 ; MLS, macrolides, lincosamides et streptogramines ; NOR, norfloxacine ; S,; TC, tétracyclines ; TPP+: ion tétraphénylphosphonium.


A

 

B

 

Figure 22. Représentation schématique des transporteurs de la famille MFS.

En (A), un transporteur à 12 segments transmembranaires et en (B) un transporteur à 14 TMS, d’après [336].


Tableau 5. Pompes d’efflux de la famille MFS conférant une résistance spécifique.

 

 

Transporteur

Organisme

Substrats

Références

à 12 TMS

 

 

 

 

Bcr

E. coli

Sulfonamide

[26]

 

CmlA

P. aeruginosa

C

[28]

 

CmlA2

E. aerogenes

C

[320]

 

Flo

S. typhimurium, E. coli

C, florfénicol

[33, 437]

 

LmrA

S. lincolnensis

Lincomycine

[452]

 

Mef(A)

Streptocoques

M14-15

[396]

 

Ptr

S. pristinaespiralis

Pristinamycine

[29]

 

Tap

M. tuberculosis

TC

[5]

 

TetA-TetE, TetG, TetH , TetI, TetJ, TetZ

Bactéries à Gram-négatif

TC

[63]

 

TetV

Mycobactéries

TC

[426]

à 14 TMS

 

 

 

 

TetK, TetL

Bactéries à Gram-positif

TC

[63]

 

VarS

S. virginiae

Virginiamycine S

[196]

C, chloramphénicol ; M14-15, macrolides à 14 et 15 chaînons ; TC, tétracyclines.

 


Tableau 6. Pompes d’efflux MDR de la famille MFS.

 

Transporteur

Organisme

Substrats

Références

à 12 TMS

 

 

 

 

Blt

B. subtilis

FQ, doxorubicine, EtBr, ACR, R6G, TPP+, spermidine

[4, 440]

 

Bmr

B. subtilis

C, FQ, doxorubicin, puromycin, EtBr, ACR, R6G, TPP+

[279, 282]

 

Cme

C. difficile

ERY, EtBr, safranine O

[193]

 

Cmr

C. glutamicum

ERY, TC, puromycine, bléomycine

[150]

 

EmeA

E. faecalis

NOR, EtBr

[154]

 

EmrD

E. coli

CCCP, salicylate

[289]

 

Lde

L. monocytogenes

FQ, EtBr, ACR

[111]

 

LmrP

L. lactis

MLS, TC, daunomycine, EtBr, H33342, R123, TPP+

[322]

 

MdfA (Cmr, CmlA)

E. coli

certains AM, C, ERY, FQ, TC, daunomycine, rifampicine, puromycine, EtBr, R6G, BZC, TPP+

[85]

 

MdrL

L. monocytogenes

M, céfotaxime, EtBr, métaux lourds

[244]

 

MdtA

L. lactis

MLS, TC

[316]

 

NorA

S. aureus

FQ hydrophiles, EtBr, ACR, CET, TPP+, BZC

[166, 283]

 

NorB

S. aureus

FQ, EtBr, CET

[406]

 

PmrA

S. pneumoniae

FQ hydrophiles, EtBr, ACR

[109]

 

Tap

M. fortuitum

AM, TC

[5]

à 14 TMS

 

 

 

 

BcrA

B. cepacia

NAL, TC

[438]

 

Bmr3

B. subtilis

FQ, ACR, EtBr, TPP+

[293]

 

EfpA

M. smegmatis

FQ, AQ

[204]

 

EmrB

E. coli

NAL, CCCP, thiolactomycine, tetrachlorosalicylanilide

[217]

 

LfrA

M. smegmatis

FQ hydrophiles, EtBr, ACR, certains AQ

[210, 399]

 

MdeA

S. aureus

Virginiamycine, novobiocine, EtBr, BZC

[140]

 

P55

M. tuberculosis, M. bovis

AM, TC

[385]

 

QacA

S. aureus

AQ mono- et divalents, chlorhexidine, CV, EtBr, R6G

[256]

 

QacB

S. aureus

AQ monovalent, chlorhexidine, CV, EtBr, R6G

[310]

 

Rv1877

M. smegmatis

ERY, TC, kanamycine, AQ

[204]

 

VceB

V. cholerae

M, NAL, FQ hydrophobes, CCCP

[70]

ACR, acriflavine ; AM, aminoglycosides ; AQ, ammoniums quaternaires ; BZC, chlorure de benzalkonium ; C, chloramphénicol ; CCCP, chlorophénylhydrazone du mésoxazolonitrile ; CET: cétrimide ; CV, cristal violet ; ERY, érythromycine ; EtBr, bromure d’éthidium ; FQ, fluoroquinolones ; H33342, Hoechst 33342 ; M, macrolides ; MLS, macrolides-lincosamides-streptogramines ; NAL, acide nalidixique ; NOR, norfloxacine ; R123, rhodamine 123 ; R6G, rhodamine 6G ; TC, tétracyclines ; TPP+, bromure de tétraphénylphosphonium.

 


Figure 23 FIGURE Glp
Tableau
7. Systèmes d’efflux de la famille RND.

 

Transporteur

Organisme

MFP

OMF

Substrats

Références

AcrB

E. aerogenes

AcrA

TolC

CIP, NOR, C, M, TC, ACR, SDS, sels biliaires

[331]

AcrB

E. coli

AcrA

TolC

b-lactames, C, M, FQ, NAL, TC, RP, novobiocine, triclosan, EtBr, sels biliaires

[295]

AcrB

H. influenzae

AcrA

 

ERY, RP, novobiocine, EtBr, CV

[367]

AcrB

Klebsiella spp.

AcrA

 

CIP

[247]

AcrB

S. typhimurium

AcrA

TolC

FQ

[288]

AcrD

E. coli

 

 

AM

[352]

AcrF

E. coli

AcrE

TolC

b-lactames, C, M, NAL, FQ, TC, RP, novobiocine, triclosan, EtBr, sels biliaires

[289]

AdeB

A. baumannii

AdeA

AdeC

FQ

[228]

AmrB

B. pseudomallei

AmrA

OprA

AM, M

[262]

ArpB

P. putida

ArpA

ArpC

TC, C, carbenicilline, streptomycine, ERY, novobiocine

[176]

BmeB

B. fragilis

BmeA

BmeC

Certains céphèmes, peptides antimicrobiens, acide fusidique, novobiocine, puromycine

[411]

BpeB

B. pseudomallei

BpeA

OprB

Gentamicine, streptomycine, ERY, ACR

[49]

CeoB

B. cenocepacia

CeoA

OpcM

CIP, C, TM, salicylate

[270]

CmeB

C. jejuni

CmeA

CmeC

b-lactames, FQ, ERY, C, RP, TC, EtBr, acridine orange, SDS, sels biliaires

[207, 333]

EefB

E. aerogenes

EefA

EefC

C, CIP, NOR, ERY, TC, doxycycline

[243]

EmhB

P. fluorescens

EmhA

EmhC

C, NAL

[125]

MdtB-MdtC

E. coli

MdtA

TolC

novobiocine, sels biliaires, SDS

[269]

HefB

H. pylori

HefA

HefC

ERY, clindamycine, TC, pénicilline G, EtBr, novobiocine

[190]

MexB

P. aeruginosa

MexA

OprM

b-lactames, C, M, FQ, NAL, TC, RP, TM, novobiocine, SDS, CV, EtBr

[329]

MexD

P. aeruginosa

MexC

OprJ

b-lactames, C, M, FQ, TC, TM, CV, EtBr

[328]

MexF

P. aeruginosa

MexE

OprN

C, FQ, imipénèm, TM

[183]

MexI

P. aeruginosa

MexH

OpmD

NOR, EtBr, ACR, R6G

[383]

MexK

P. aeruginosa

MexJ

OprM

TC, ERY, triclosan

[65]

MexW

P. aeruginosa

MexV

OprM

FQ, TC, C, ERY, EtBr, ACR

[206]

MexY

P. aeruginosa

MexX

OprM

AM, EtBr

[255]

MtrD

N. gonnorhoeae

MtrC

MtrE

CIP, M, TC, peptides antimicrobiens, sels biliaires

[116, 384]

SdeB

S. marcescens

SdeA

 

FQ, C, EtBr, SDS

[189]

SdeY

S. marcescens

SdeX

 

ERY, TC, NOR, BZC, EtBr, ACR, R6G

[53]

SmeB

S. maltophilia

SmeA

SmeC

AM, FQ

[205]

SmeE

S. maltophilia

SmeD

SmeF

TC, C, ERY, quinolones, EtBr

[10]

TbtB

P. stutzeri

TbtA

TbtM

Tributyltine, C, NAL, sulfaméthoxazole

[155]

TtgB

P. putida

TtgA

TtgC

C, NAL, TC, ampicilline

[401]

XepB

P. gingivalis

XepA

XepC

RP, puromycine, EtBr, SDS

[147]

YerP

B. subtilis

-

-

Surfactine, EtBr, ACR

[409]

YhiV

E. coli

YhiU

TolC

ERY, doxorubicine, déoxycholate, CV, EtBr, R6G

[289]

ACR, acriflavine ; AM, aminoglycosides ; BZC, chlorure de benzalkonium ; C, chloramphénicol ; CIP, ciprofloxacine ; CV, cristal violet ; ERY, érythromycine ; EtBr, bromure d’éthidium ; FQ, fluoroquinolones ; M, macrolides ; NAL, acide nalidixique ; NOR, norfloxacine ; R6G, rhodamine 6G ; RP, rifampicine ; SDS, sel de sodium de l’acide dodécyl sulfonique ; TC, tetracyclines ; TM, triméthoprime.

 


 

 

 

Figure 24. Représentation schématique d’un transporteur de la famille RND, d’après [336].


 

 

Figure 25. Modèle proposé pour le complexe AcrB-TolC par Murakami et al. [267].

Les trois monomères de AcrB sont en bleu, vert et rose ; les trois monomères de TolC sont en rouge, orange foncé et orange clair.


Tableau 8. Systèmes d’efflux de la famille MATE.

 

Transporteur

Organisme

Substrats

Références

BexA

B. thetaiotaomicron

CIP, NOR, EtBr

[257]

CdeA

C. difficile

FQ, EtBr, ACR

[82]

HmrM

H. influenzae

NOR, DAPI, anthracyclines, EtBr, TPP+, H33342, berbérine

[443]

MepA

S. aureus

Tigécycline, NOR, EtBr, TPP+, DAPI

[156, 248]

NorE (YdhE)

E. coli

CIP, NOR, TPP+

[263, 445]

NorM

V. parahaemolyticus

CIP, NOR, kanamycine, streptomycine, EtBr

[40, 263]

NorM

Neisseria spp.

ACR, EtBr, berbérine

[361]

PmpM

P. aeruginosa

FQ, ACR, BZC, EtBr, TPP+

[124]

VcmA

V. cholerae non-O1

FQ, anthracyclines, streptomycine, kanamycine, EtBr, DAPI, H33342, ACR

[143]

VcrM

V. cholerae non-O1

ACR, DAPI, H33342, R6G, EtBr, TPP+

[142]

VmrA

V. parahaemolyticus

ACR, DAPI, EtBr, TPP+

[55]

ACR, acriflavine ; BZC, chlorure de benzalkonium ; CIP, ciprofloxacine ; DAPI, 4’,6-diamidino-2-phénylindole ; EtBr, bromure d’éthidium ; FQ, fluoroquinolones ; H33342, Hoechst 33342 ; NOR, norfloxacine ; QAC, ammoniums quaternaires ; R6G, rhodamine 6G ; TPP+, bromure de tétraphénylphosphonium.

 

 

Tableau 9. Systèmes d’efflux de la famille SMR.

 

Transporteur

Organisme

Substrats

Références

EbrA-EbrB

B. subtilis

EtBr, ACR, pyronine Y, safranine O

[242]

EmrE

E. coli

EtBr, ACR

[446]

EmrE

P. aeruginosa

EtBr, ACR, AM hydrophiles

[203]

Mmr

M. tuberculosis

ERY, EtBr, ACR, TPP+, pyronine Y, safranine O

[77]

QacE

Bactéries à Gram-négatif

Sulfonamides, EtBr, AQ

[188]

QacEΔ1

Bactéries à Gram-négatif

Sulfonamides, CIP, gentamicine, TC, EtBr, AQ

[188]

QacG

Staphylococcus spp.

EtBr, AQ

[126]

QacH

S. saprophyticus

EtBr, AQ

[126]

Smr (QacC/Ebr/QacD)

S. aureus

EtBr, AQ, TPP+

[308]

YkkC-YkkD

B. subtilis

C, TC, streptomycine, EtBr, TPP+, pyronine Y

[148]

ACR, acriflavine ; AM, aminoglycosides ; AQ, ammoniums quaternaires ; C, chloramphénicol ; CIP, ciprofloxacine ; ERY, érythromycine ; EtBr, bromure d’éthidium ; TC, tétracyclines ; TPP+, bromure de tétraphénylphosphonium.


 

Figure 26. Représentation schématique d’un transporteur de la famille SMR, d’après [336].

 

 

Figure 27. Représentation en ruban de EmrE [227].

Quatre protéines EmrE (en bordeaux, gris, bleu et vert) forment un tétramère : le système de transport est composé de deux hétérodimères, chacun contenant deux protéine EmrE de conformations différentes. Le résidu Glu14 (TMS 1) est représenté en sphères rouges. N, extrémité N-terminale, C, extrémité C-terminale.


 

 

 

 

 

 

Vers TolC

 

 

Figure 28. Coupe de la structure de AcrB d’après [218].

La cavité centrale du transporteur située à la base du périplasme est accessible aux substrats à partir du cytoplasme et depuis le périplasme ; les substrats sont ensuite efflués vers TolC.


Tableau 10. Pompes d’efflux touchant les fluoroquinolones.

 

Organisme

Pompe

Substrats

Famille

Spécificité

Références

Bactéries à Gram positif

 

 

 

 

B. subtilis

Blt

FQ

MFS

MDR

[4, 440]

Bmr

FQ

MFS

MDR

[279, 282]

Bmr3

FQ

MFS

MDR

[293]

E. faecalis

EfrAB

CIP, NOR

ABC

MDR

[197]

EmeA

NOR

MFS

MDR

[154]

L. lactis

LmrA

FQ

ABC

MDR

[417]

L. monocytogenes

Lde

FQ

MFS

MDR

[111]

S. aureus

NorA

FQ hydrophiles

MFS

MDR

[166, 283]

S. pneumoniae

PmrA

FQ hydrophiles

MFS

MDR

[109]

Bactéries à Gram négatif

 

 

 

 

A. baumannii

AdeB

FQ

RND

MDR

[228]

B. cenocepacia

CeoB

CIP

RND

MDR

[270]

B. thetaiotaomicron

BexA

CIP, NOR

MATE

MDR

[257]

C. difficile

CdeA

FQ

MATE

MDR

[82]

C. jejuni

CmeB

FQ

RND

MDR

[207, 333]

E. aerogenes

AcrB

CIP, NOR,

RND

MDR

[331]

E. coli

MdfA (Cmr, CmlA)

FQ

MFS

MDR

[85]

AcrB

FQ

RND

MDR

[295]

AcrF

FQ

RND

MDR

[289]

NorE (YdhE)

CIP, NOR

MATE

MDR

[263, 445]

H. influenzae

HmrM

NOR

MATE

MDR

[443]

Klebsiella spp.

AcrB

CIP

RND

MDR

[247]

N. gonnorhoeae

MtrD

CIP

RND

MDR

[116]

P. aeruginosa

MexB

FQ

RND

MDR

[329]

MexD

FQ

RND

MDR

[328]

MexF

FQ

RND

MDR

[183]

MexI

NOR

RND

MDR

[383]

MexW

FQ

RND

MDR

[206]

PmpM

FQ

MATE

MDR

[124]

S. maltophilia

SmeB

FQ

RND

MDR

[205]

SmeE

quinolones

RND

MDR

[10]

S. marcescens

SdeY

NOR

RND

MDR

[53]

S. typhimurium

AcrB

FQ

RND

MDR

[288]

V. cholerae

VceB

FQ hydrophobes

MFS

MDR

[70]

V. cholerae non-O1

VcaM

CIP, NOR

ABC

MDR

[144]

VcmA

FQ

MATE

MDR

[143]

V. parahaemolyticus

NorM

CIP, NOR

MATE

MDR

[40, 263]

Bactéries à Gram positif et négatif

QacEΔ1

CIP

SMR

MDR

[188]

Mycobactéries

 

 

 

 

 

M. tuberculosis

Rv2686c - Rv2687c - Rv2688c

FQ

ABC

Spécifique

[306]

M. smegmatis

EfpA

FQ

MFS

MDR

[204]

LfrA

FQ hydrophiles

MFS

MDR

[210, 399]

Mycoplasmes

 

 

 

 

 

M. hominis

Md1-Md2

CIP, NOR

ABC

MDR

[338]

 

Tableau 11. Pompes d’efflux touchant les macrolides, lincosamides et streptogramines chez les organismes producteurs.

 

Organisme

Transporteur

Antibiotique

Famille

Références

S. thermotolerans

Car(A)

Carbomycine (M16)

ABC II

[381]

S. erythraea

Ert(X)

Erythromycine ? (M14)

ABC II

[299]

S. antibioticus

Ole(B)

Oléandomycine (M14)

ABC II

[296]

OleC – OleC5

ABC I

[351]

S. ambofaciens

Srm(B)

Spiramycine (M16)

ABC II

[381]

S. fradiae

Tlr(C)

Tylosine (M16)

ABC II

[359]

S. lincolnensis

Lmr(C)

Lincomycine (L)

ABC II

[317]

Lmr(A)

MFS

[452]

S. pristinaespiralis

Ptr

Pristinamycine (S)

MFS

[29]

S. virginiae

Var(M)

Virginiamycine (S)

ABC II

[172]

Var(S)

Virginiamycine S (SB)

MFS

[196]

M14, M16, macrolides à 14 et 16 chaînons ; L, lincosamides ; S, streptogramines ; SB, streptogramines B ; ABC I, ABC II, transporteur ABC de type I ou II ; MFS, transporteur de la famille MFS ; ?, transporteur supposé. 

 

 

 

 

Figure 29. Arbre phylogénétique simplifié des protéines ABC de type II, d’après [347].

Orf5 réfère à Msr(D) ; la protéine UvrA (E. coli) impliquée dans la réparation de l’ADN a été incluse pour comparaison.


Tableau 12. Autres pompes d’efflux touchant les macrolide, lincosamides et streptogramines.

 

Organisme

Pompe

Substrats

Famille

Spécificité

Références

Bactéries à Gram positif

 

 

 

 

E. faecalis

Lsa

L, SA

ABC II

Spécifique

[388]

E. faecium

Msr(C)

M, SB

ABC II

Spécifique

[386]

L. lactis

LmrP

MLS

MFS

MDR

[322]

L. lactis

MdtA

MLS

MFS

MDR

[316]

L. monocytogenes

MdrL

M

MFS

MDR

[244]

S. aureus

MdeA

S

MFS

MDR

[140]

S. aureus

Vga(A)

L, SA

ABC II

Spécifique

[9]

S. aureus

Vga(B)

S

ABC II

Spécifique

[8]

S. epidermidis

Msr(A)

M14-15, SB

ABC II

Spécifique

[357]

Streptococcus spp.

Mef(A)

M14-15

MFS

Spécifique

[396]

Streptococcus spp.

Msr(D)

M14-15-16

ABC II

Spécifique

[74]

S. rochei F20

Msr

M

ABC

MDR

[90]

Bactéries à Gram négatif

 

 

 

 

B. pseudomallei

AmrB

M

RND

MDR

[262]

B. pseudomallei

BpeB

ERY

RND

MDR

[49]

C. glutamicum

Cmr

ERY

MFS

MDR

[150]

C. jejuni

CmeB

ERY

RND

MDR

[207, 333]

E. aerogenes

AcrB

M

RND

MDR

[331]

E. coli

AcrB

M

RND

MDR

[295]

E. coli

AcrF

M

RND

MDR

[289]

E. coli

MacB

M14-15

ABC

Spécifique

[182]

E. coli

MdfA (Cmr, CmlA)

ERY

MFS

MDR

[85]

E. coli

YhiV

ERY

RND

MDR

[289]

H. influenzae

AcrB

ERY

RND

MDR

[367]

N. gonnorhoeae

MtrD

M

RND

MDR

[116]

P. aeruginosa

MexB

M

RND

MDR

[329]

P. aeruginosa

MexD

M

RND

MDR

[328]

P. aeruginosa

MexK

ERY

RND

MDR

[65]

P. aeruginosa

MexW

ERY

RND

MDR

[206]

P. putida

ArpB

ERY

RND

MDR

[176]

S. maltophilia

SmeE

ERY

RND

MDR

[10]

S. marcescens

SdeY

ERY

RND

MDR

[53]

V. cholerae

VceB

M

MFS

MDR

[70]

Mycobactéries

 

 

 

 

 

M. smegmatis

Rv1877

ERY

MFS

MDR

[204]

M. tuberculosis

Mmr

ERY

SMR

MDR

[77]

ABC II, transporteur ABC de type II ; ERY, érythromycine (M14) ; M14, M15, M16, macrolides à 14, 15 et 16 chaînons ; L, lincosamides ; SA, SB, streptogramines de type A et B.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 30. Structures d’une tétracycline, la doxycycline, et d’un dérivé 13-thio de la tétracycline, le 13-cyclopentylthio-tétracycline, qui est un inhibiteur de la pompe d’efflux Tet(B).


Figure 31. Inhibiteurs connus des systèmes d’efflux eucaryotes.

 

Figure 32. Structures des inhibiteurs les plus efficaces de la pompe NorA identifiés par Markham et al. [240].


 

 

 

 

Figure 33. Structures d’une phénothiazine, la chlorpromazine, et de deux phénylpipéridines inhibiteurs sélectifs de la capture de la sérotonine, le paroxétine (actif) et le fémoxétine (inactif).

 

 

 

Figure 34. Structures d’inhibiteurs naturels de la pompe NorA.


 

 

Figure 35. Structures d’inhibiteurs de pompes d’efflux de la famille RND.

Un criblage de composés synthétiques a permis d’identifier le dipeptide amide, PAbN (1), comme IPE de pompes RND. A partir de ce squelette peptidique, des efforts pour améliorer sa stabilité aux protéases ont conduit à (2) qui a deux acides aminés D. La synthèse d’analogues a abouti à la molécule (3) qui est moins toxique que (4).

D’autres molécules, qui ne contiennent pas ce squelette peptidique, telles le benzimidazole (5) ou l’arylpipérazine (6), peuvent aussi agir comme IPE de systèmes RND.

 

 

 

 

 

Figure 36. Structures de quinolines utilisées comme inhibiteurs des systèmes RND.

Partant d’une pyridoquinoline (6), la synthèse d’analogues a montré que des composés 4-substitués, comme des thioalkyl- (7), alkylamino- (8) et alkoxy-quinolines (9) sont des inhibiteurs efficaces des transporteurs RND.

 


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 37. Conception rationnelle et amélioration d’inhibiteurs spécifiques du système MexAB-OprM de P. aeruginosa.

Partant de la molécule tête de série (10), les caractéristiques clés pour l’inhibition des pompes d’efflux ont été identifiées. Ceci a permis la conception de (11), bâtie sur un squelette pyridopyrimidine qui respecte ces critères et qui a de meilleures propriétés physico-chimiques que (10). Grâce à des études de relation structure-activité, ce squelette a encore été optimisé, conduisant au puissant IPE (12). Comme cette molécule est peu stable, des modifications chimiques supplémentaires ont été apportées, aboutissant à la molécule (13).

 

 

 

 

 

Figure 38. Inhibiteurs des pompes d’efflux de type ABC.


 

 

Figure 39. Structures de substrats de la pompe d’efflux NorA.

 

 

 

Figure 40. Structures d’inhibiteurs de pompes d’efflux utilisés dans cette étude.


 

Figure 41. Robot Biomek 2000 installé au laboratoire.


Tableau 13. Composition du milieu de conservation des souches.

 

 

Pour 200 ml de milieu

Infusion de cœur cervelle

7,4 g

Glycérol

30 ml

Eau distillée q.s.p.

170 ml

Après mélange, le milieu est stérilisé 15 min à 120°C, puis réparti en tubes de 1 ml.

 

Tableau 14. Composition du milieu de Mueller Hinton (MH)a.

 

 

Pour 1 litre de milieu

Infusion de viande de boeuf

300 ml

Hydrolysat de caséine

17,5 g

Amidon

1,5 g

Eau distillée q.s.p.

1000 ml

pH

7,3 ± 0,1

a La composition des milieux gélosés est identique à part la présence d’agar purifié à 10 g/l.

 

Tableau 15. Composition du milieu de Luria-Bertani (LB).

 

 

Pour 1 litre de milieu

Bacto-Tryptone

10 g

Extrait de levure

5 g

NaCl

10 g

Eau distillée q.s.p.

1000 ml

pH (ajusté avec NaOH)

7

 

 

 

 

 

 

 

 

Tableau 16. Composition du milieu M17a.

 

 

Pour 1 litre de milieu

Digestion pancréatique de caséine

5,0 g

Peptone de soja

5,0 g

Extrait de bœuf

5,0 g

Extrait de levure

2,5 g

Acide ascorbique

0,5 g

Sulfate de magnésium

0,25 g

β-glycérophosphate disodique

19,0 g

pH

6,9 ± 0,2

Eau distillée q.s.p.

950 ml

Lactose à 10%

50 ml

a La composition des milieux gélosés est identique à part la présence d’agar purifié à 10 g/l.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 42. Représentation schématique du vecteur plasmidique pBAD/Myc-HisA (Invitrogen).

colE1, origine de réplication de E. coli ; araC, gène codant la protéine régulatrice AraC ; pBAD, promoteur de l’opéron arabinose de E. coli ; ATG, codon d’initiation ; MCS, site de clonage multiple ; myc, gène codant l’épitope Myc (Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu) ; (His)6, étiquette polyhistidine ; T, terminateur ; ampR, gène de résistance à l’ampicilline.


 

 

 

FICHE DE DONNEES

 

 

Numéro attribué

573-01-ND230B

Masse pesée

10,8 mg

Opérateur

Poste tél

Nicolas

76744

 

 

Structure de la molécule                 

 

 

 

Nom de la molécule

(ou référence)

ND 230b

Formule brute

C21H32N2O4Si

 

Masse molaire

404,58

Famille

b-lactames

Libre ou Brevetée

(L ou B ou ?)

Libre

Stock restant

OK

Solubilité DMSO

OK

 

 

Commentaires (stabilité, pureté, synthèse, autre solvant…)

 

 

 

 

Figure 43. Exemple d’une fiche de données d’une molécule entrant dans la Chimiothèque.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 44. CMI de la molécule A en fonction de la concentration en antibiotique : isobologrammes de l’association molécule A/antibiotique.

En vert, cas d’une association synergique entre les molécules, en rose cas d’un effet additif et en bleu, cas d’un antagonisme.


 

Figure 45. Schéma du protocole suivi lors des expériences d’accumulation de la ciprofloxacine.


Tableau 17. Composition des tampons utilisés pour les techniques de biologie moléculaire.

 

Composants

 

Concentration

Tampon TAE

 

 

Tris

 

40 mM

Acide acétique

 

5 mM

EDTA

 

1 mM

pH 7,8

 

 

 

 

 

Tampon TBE

 

 

Tris

 

90 mM

Acide borique

 

90 mM

EDTA

 

2 mM

pH 8

 

 

 

 

 

 

Tableau 18. Composition des tampons utilisés pour l’extraction de l’ADN plasmidique.

 

Composants

 

Concentration

Tampon de lyse

 

 

Glucose

 

50 mM

Tris-HCl pH 8

 

25 mM

EDTA pH 8

 

10 mM

 

 

 

Solution de lyse

 

 

NaOH

 

0,2 N

SDS

 

1 %

 

 

 

Tampon de précipitation

 

 

Acétate de potassium

 

3 M

Acide acétique pH 4,8

 

5 M

 


Tableau 19. Séquence des amorces utilisées pour l’amplification du gène msr(A).

 

Nom

Séquence

Taille (nt)

Tm (°C)

msrABADA1

5’-GTG CTC GAG AAT GGA ACA ATA TAC AAT TAA-3’

30

48

msrABADA2

5’-GTT CTG CAG AGT TAT ATC ATG AAT AGA TTG-3’

30

52

 

Les séquences soulignées correspondent aux sites de restriction des enzymes XhoI ou PstI.

 


Tableau 20. Tampons utilisés pour la préparation de bactéries compétentes par choc thermique.

 

Composants

 

Concentration

Tampon TFB1

 

 

KCl

 

30 mM

CaCl2

 

10 mM

MnCl2

 

50 mM

RbCl

 

100 mM

Glycérol

 

15%

pH 5,8

 

 

 

 

Tampon TFB2

 

 

MOPS1

 

10 mM

CaCl2

 

75 mM

RbCl

 

10 mM

Glycérol

 

15%

pH ajusté à 6,5 avec KOH 1M

 

Les tampons sont filtrés sur filtre Millipore 0,22 µM.

1 MOPS : acide 3-(N-morpholino) propane sulfonique.

 


Tableau 21. Séquence des amorces utilisées pour le séquençage.

 

 Nom

Séquence

msrABADA1

5’-GTG CTC GAG AAT GGA ACA ATA TAC AAT TAA-3’

msrABADA2

5’-GTT CTG CAG AGT TAT ATC ATG AAT AGA TTG-3’

msrA1

5’-ATG AAC CTA CAA ATC ACT TGG-3’

msrA2

5’-GAA TGG AAC ATT TGG AAG AAG-3’

msrA3

5’-TGA AGC ACT TGA GCG TTC TTG-3’

 

 

 

 

Tableau 22. Composition du gel de séquence.

 

Réactifs

Volumes

Solution concentrée d’acrylamide/bis-acrylamide + uréea

50 ml

TEMED

35 µl

Persulfate d’ammonium 10%

250 µl

a Concentrations finales : acrylamide 4,25 % et urée 6 M en tampon TBE

 


A

 

B

 

Traitement informatique de la séquence

 
 

 

 


 

 

Figure 46. Exemple d'un gel de séquençage et d'un électrophorégramme.

L’image de la migration électrophorétique des produits d’extension (A) est traitée à l’aide du logiciel « Sequencing Analysis 3.3 » afin de déterminer la séquence nucléotidique du produit de chaque piste (B).


Tableau 23. Composition du tampon échantillon.

 

Composants (pour 8 ml de tampon)

V (ml)

Eau distillée

4

Tris 0,5 M pH 6,8

1

Glycérol

0,8

SDS 10% (p/v)

1,6

2-b mercaptoéthanol

0,4

Bleu de bromophénol 0,05% (p/v)

0,2

 

 

 

Tableau 24. Composition des gels de séparation (12%) et de concentration (4%).

 

Composants (pour 10 ml de gel)

12%

4%

Eau distillée

3,35 ml

6,1 ml

Tris 1,5 M pH 8,8

2,5 ml

-

Tris 0,5 M pH 6,8

-

2,5 ml

SDS 10% (p/v)

100 µl

100 µl

Acrylamide/Bis-acrylamide (37,5/1)

4 ml

1,3 ml

Persulfate d’ammonium 10%

50 µl

50 µl

TEMED

5 µl

10 µl

 

 

 

Tableau 25. Composition du tampon de migration, pH 8,3.

 

Composants

 

Tris

25 mM

Glycine

0,2 M

SDS

0,1%


Tableau 26. Protéines utilisées pour la construction par homologie du modèle de la protéine Msr(A).

 

Protéines utilisées

Code PDB

Références

ArsA

1IHU

[456]

BtuCD

1L7V

[214]

CFTR

1R0X

[199]

GlcV

1OXX

[421]

HisP

1B0U

[145]

HlyB

1MTO

[377]

MalK

1Q12

[54]

MJ0796

1L2T

[389]

Rad50

1F2U

[137]

TAP1

1JJ7

[102]

 

 

 

 

 

 

MEQYTIKFNQINHKLTDLRSLNIDHLYAYQFEKIALIGGNGTGKTTLLNMIAQKTKPESG

TVETNGEIQYFEQLNMDVENDFNTLDGSLMSELHIPMHTTDSMSGGEKAKYKLANVISNY

SPILLLDEPTNHLDKIGKDYLNNILKYYYGTLIIVSHDRALIDQIADTIWDIQEDGTIRV

FKGNYTQYQNQYEQEQLEQQRKYEQYISEKQRLSQASKAKRNQAQQMAQASSKQKNKSIA

PDRLSASKEKGTVEKAAQKQAKHIEKRMEHLEEVEKPQSYHEFNFPQNKIYDIHNNYPII

AQNLTLVKGSQKLLTQVRFQIPYGKNIALVGANGVGKTTLLEAIYHQIEGIDCSPKVQMA

YYRQLAYEDMRDVSLLQYLMDETDSSESFSRAILNNLGLNEALERSCNVLSGGERTKLSL

AVLFSTKANMLILDEPTNFLDIKTLEALEMFMNKYPGIILFTSHDTRFVKHVSDKKWELT

GQSIHDIT

 

Figure 47. Séquence d’acides aminés de la protéine Msr(A) [357].

Les motifs Walker A et B du NBD N-terminal sont en caractères rouges gras, le motif Signature de ce domaine est souligné en rose ; les mêmes séquences dans le domaine C-terminal sont en bleu et turquoise. Les résidus glutamine du Q-linker sont en vert.


 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 48. Exemple de code attribué aux molécules de la Chimiothèque.

Il s’agit de la molécule non brevetée de l’équipe 01 de l’UMR CNRS 7573, située dans la plaque n°12 et en position F09. Cette molécule se trouve dans la plaque n° 573-01-12.

 


 

Figure 49. Fiche d’enregistrement d’une molécule dans la base de données.

Les informations relatives à la molécule (structure, identificateurs…) sont entrées dans la base lors de la mise en plaque des produits ; les résultats de criblage (en bas) sont renseignés au fur et à mesure. Les résultats des tests sur les souches sensibles (souches ATCC de E. coli et S. aureus) figurent dans les cases rouges bilan ; dans le cas de molécules actives, les cases CMI sont également remplies. Les résultats des tests en présence d’antibiotique sur les deux souches résistantes de S. aureus étudiées sont également entrés dans la base (cases roses).


Tableau 27. CMI de différents antibiotiques vis-à-vis des souches sensibles de référence, déterminées avec le Biomek 2000.

 

 

CMI (mg/ml)

Antibiotiques

E. coli

ATCC 25922

P. aeruginosa

ATCC 29653

S. aureus

ATCC 25923

E. faecalis

ATCC 29212

réfa

expb

 

réf

exp

 

réf

exp

 

réf

exp

 

 

 

 

 

 

 

 

 

 

 

 

Ampicilline

2 - 8

8

 

-

ndc

 

0,25 - 1

0,5

 

0,5 - 2

4

 

 

 

 

 

 

 

 

 

 

 

 

CIP

0,004 - 0,015

0,003

 

0,25 - 1

0,5

 

0,12 - 0,5

0,25

 

0,25 - 2

2

 

 

 

 

 

 

 

 

 

 

 

 

ERY

-

nd

 

-

nd

 

0,12 - 0,5

0,25

 

1 - 4

1

 

 

 

 

 

 

 

 

 

 

 

 

Gentamicine

0,25 - 1

0,5

 

0,5 - 2

1

 

0,12 - 1

0,5

 

4 - 16

8

 

 

 

 

 

 

 

 

 

 

 

 

Tétracycline

1 - 4

2

 

8 - 32

32

 

0,12 - 1

0,5

 

8 - 32

16

a CMI de référence (d’après [11]) ; b Moyenne des CMI déterminées par le Biomek 2000 et réalisées en triplicate ; c Non déterminé, résistance naturelle.


Figure 50. Courbes de croissance de E. coli ATCC 25922 (dilution initiale de l’inoculum au 1/100ème), en fonction du temps en présence de différentes concentrations en DMSO, 0%, 1%, 5% et 10%.


 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 


Figure 51. Courbes de croissance de S. aureus ATCC 25923 en fonction du temps en présence de milieu MH seul, de MH + DMSO à 1% (témoin négatif), d’ampicilline à 16 µg/ml (témoin positif), et de quatre molécules testées à 100 µg/ml, appelées A, B, C et D. Ces quatre molécules représentent les exemples les plus typiques de courbes obtenues pour les molécules testées.

 

 

 

01

02

03

04

05

06

07

08

09

10

11

12

A

 

 

 

 

 

 

 

 

+

 

 

 

B

 

 

 

 

 

 

 

 

 

 

 

 

C

 

 

 

 

 

 

 

 

 

++

 

 

D

 

 

 

 

 

 

 

 

 

 

++

 

E

 

 

 

 

 

 

 

 

 

 

+

 

F

 

 

 

 

 

 

 

 

 

 

+

 

G

 

 

 

 

 

 

 

 

++

++

 

 

H

 

++

 

 

 

 

 

 

 

++

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 52. Présentation des résultats d’une plaque de 80 molécules testées, obtenue après traitement par le programme informatique.

Les cases jaunes correspondent aux molécules inactives, les cases oranges aux molécules peu actives (+), et enfin les cases rouges aux molécules actives (++).


 


 

 
Figure 53. Répartition des molécules actives (155) vis-à-vis de S. aureus ATCC 25923 en fonction de leur CMI.


 

 

 

 

 

 

R1

R2

R3

CMI (µg/ml)

Vibrindole

CH3

H

H

12,5

 

CF3

H

H

6

 

CF2Cl

H

H

6

 

CH3

Br

Br

1,5

 

CH2CH3

Br

Br

3

 

CF3

Br

Br

1,5

 

CF2Cl

Br

Br

1,5

 

CF3

F

F

3

 

CF3

NO2

NO2

1,5

 

CF3

H

Br

1,5 *

 

CF3

H

Me

5

 

CF3

COOMe

COOMe

50

 

CF3

H

COOMe

10

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Figure 54. Comparaison de l’activité d’analogues du vibrindole : CMI vis-à-vis de la souche de S. aureus ATCC 25923 en fonction des substituants présents.

* Dans le cas d’une seule substitution par Br en R3, la CMI est de 1,5 µg/ml quelque soit la position du substituant sur le cycle.


Tableau 28. Résultats du criblage des extraits bruts du Brésil à 100 µg/ml : activité antibactérienne sur les souches sensibles E. coli et S. aureus ATCC, et une souche résistante, S. aureus NorA.

 

Famille

Genre et espèce

Tissu

E. coli ATCC 25922

S. aureus ATCC 25923

S. aureus NorA

Anacardiacea

Schinus terebinthifolius

Ecorce

-

+

+

Feuille

-

+

-

Annonaceae

Annona crassifolia

Feuille

-

-

-

Graine

-

+

-

Ecorce

-

-

-

Fruit

-

-

+

Annona muricata

Feuille

-

+

-

Annona salzmanii

Fruit

-

-

-

Apocynaceae

Aspidosperma cylindrocarpon

Feuille

-

-

-

Condylocarpon isthmicum

Feuille

-

-

-

Tige

-

-

-

Himatanthus obovatus

Tige

-

-

-

Araliaceae

Didymopanax morototoni

Bois

-

-

-

Asclepiadaceae

Ditassa crassifolia

Feuille

-

-

-

Tige

-

-

-

Marsdenia altissima

Feuille

-

-

-

Tige

-

-

-

Asteraceae

Senecio jurgensenii

Tige

-

-

-

Boraginaceae

Auxemma oncocalyx

Bois

-

-

-

Cecropiacea

Cecropia pachystachya

Racine

-

-

nd

Ecorce

-

-

nd

Tige

-

-

nd

Feuille

-

-

nd

Celastraceae

Maytenus rigida

Ecorce

-

-

nd

Feuille

-

-

nd

Euphorbiaceae

Jatropha elliptica

Feuille

-

-

-

Rhizome

-

+

+

Fabaceae

Andira inermis

Feuille

-

-

-

Caesalpinia pyramidalis

Feuille

-